PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0198619.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 358aa    MW: 40103.7 Da    PI: 8.3137
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0198619.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.32.5e-52161431128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeelvv+yLk kv++ +l++  +i+evd+yk++Pw+Lp+k+  +++e yfFs+rd+ky++g r+nra++sgyWkatg+dk++ls
  Lj0g3v0198619.1  16 LPPGFRFHPTDEELVVHYLKSKVASMPLPV-AIIAEVDLYKFDPWELPSKAVFGQQERYFFSPRDQKYPNGARPNRAATSGYWKATGTDKPILS 108
                      79****************************.88***************77778999*************************************9 PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + ++++vg+kk Lvfy g+ pkg+kt+W+mheyrl
  Lj0g3v0198619.1 109 SdGHQKVGVKKALVFYGGKPPKGVKTNWIMHEYRL 143
                      967788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-6211187IPR003441NAC domain
PROSITE profilePS5100558.73816187IPR003441NAC domain
PfamPF023653.5E-2717143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MDCTESSSSR SHYPQLPPGF RFHPTDEELV VHYLKSKVAS MPLPVAIIAE VDLYKFDPWE  60
LPSKAVFGQQ ERYFFSPRDQ KYPNGARPNR AATSGYWKAT GTDKPILSSD GHQKVGVKKA  120
LVFYGGKPPK GVKTNWIMHE YRLVDKSFGP SFRTTTTHPP VPAHPSNCNK KNSLRLDDWV  180
LCRIYKKSNG TTTMPRPPPM ENDKEINTSK TMVPTMSTLS MLNTNQNTTP PSSRTYEPEG  240
LVENHDNFFH GYLTPDQSMQ NGNNNDTNDD NSFCVKRAIA PSQFLNESGS AGSSFSTKRF  300
HGDLNSGSSN TEENNNNSFV SLLSQLPQSA SFHANAILES VEDGVMRQQF QLPNINWN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-711618917167NO APICAL MERISTEM PROTEIN
1ut4_B4e-711618917167NO APICAL MERISTEM PROTEIN
1ut7_A4e-711618917167NO APICAL MERISTEM PROTEIN
1ut7_B4e-711618917167NO APICAL MERISTEM PROTEIN
3swm_A5e-711618920170NAC domain-containing protein 19
3swm_B5e-711618920170NAC domain-containing protein 19
3swm_C5e-711618920170NAC domain-containing protein 19
3swm_D5e-711618920170NAC domain-containing protein 19
3swp_A5e-711618920170NAC domain-containing protein 19
3swp_B5e-711618920170NAC domain-containing protein 19
3swp_C5e-711618920170NAC domain-containing protein 19
3swp_D5e-711618920170NAC domain-containing protein 19
4dul_A4e-711618917167NAC domain-containing protein 19
4dul_B4e-711618917167NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.88311e-125floral bud
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150343e-68AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003528438.11e-162PREDICTED: NAC transcription factor 25-like
SwissprotQ8GY421e-107NAC25_ARATH; NAC transcription factor 25
TrEMBLA0A0B2PHV81e-162A0A0B2PHV8_GLYSO; NAC domain-containing protein 18
TrEMBLI1KLG21e-162I1KLG2_SOYBN; Uncharacterized protein
STRINGGLYMA07G31220.11e-162(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.18e-91NAC domain containing protein 2